Lineage for d1fbna_ (1fbn A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1378546Family c.66.1.3: Fibrillarin homologue [53342] (1 protein)
    automatically mapped to Pfam PF01269
  6. 1378547Protein Fibrillarin homologue [53343] (4 species)
  7. 1378550Species Methanococcus jannaschii [TaxId:2190] [53344] (2 PDB entries)
  8. 1378552Domain d1fbna_: 1fbn A: [34181]
    structural genomics

Details for d1fbna_

PDB Entry: 1fbn (more details), 1.6 Å

PDB Description: crystal structure of a fibrillarin homologue from methanococcus jannaschii, a hyperthermophile, at 1.6 a
PDB Compounds: (A:) mj fibrillarin homologue

SCOPe Domain Sequences for d1fbna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbna_ c.66.1.3 (A:) Fibrillarin homologue {Methanococcus jannaschii [TaxId: 2190]}
medikikeifeniyevdlgdglkriatksivkgkkvydekiikigdeeyriwnpnkskla
aaiikglkvmpikrdskilylgasagttpshvadiadkgivyaieyaprimrelldacae
reniipilgdankpqeyanivekvdviyedvaqpnqaeiliknakwflkkggygmiaika
rsidvtkdpkeifkeqkeileaggfkivdevdiepfekdhvmfvgiwegk

SCOPe Domain Coordinates for d1fbna_:

Click to download the PDB-style file with coordinates for d1fbna_.
(The format of our PDB-style files is described here.)

Timeline for d1fbna_: