Lineage for d1fbna_ (1fbn A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (11 families) 
Family c.66.1.3: Fibrillarin homologue [53342] (1 protein) Protein Fibrillarin homologue [53343] (1 species) Species Methanococcus jannaschii [TaxId:2190] [53344] (1 PDB entry) 
Domain d1fbna_: 1fbn A: [34181]
Details for d1fbna_
PDB Entry: 1fbn (more details), 1.6 Å
PDB Description: crystal structure of a fibrillarin homologue from methanococcus jannaschii, a hyperthermophile, at 1.6 a
SCOP Domain Sequences for d1fbna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbna_ c.66.1.3 (A:) Fibrillarin homologue {Methanococcus jannaschii}
medikikeifeniyevdlgdglkriatksivkgkkvydekiikigdeeyriwnpnkskla
aaiikglkvmpikrdskilylgasagttpshvadiadkgivyaieyaprimrelldacae
reniipilgdankpqeyanivekvdviyedvaqpnqaeiliknakwflkkggygmiaika
rsidvtkdpkeifkeqkeileaggfkivdevdiepfekdhvmfvgiwegk
SCOP Domain Coordinates for d1fbna_:
Click to download the PDB-style file with coordinates for d1fbna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fbna_:
- d1fbna_ appears in SCOP 1.57
- d1fbna_ appears in the current release, SCOPe 2.08
View in 3D