Lineage for d5h74f1 (5h74 F:1-76)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106806Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2106807Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2107090Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2107091Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2107092Species Chicken (Gallus gallus) [TaxId:9031] [311384] (48 PDB entries)
  8. 2298507Domain d5h74f1: 5h74 F:1-76 [341808]
    Other proteins in same PDB: d5h74a1, d5h74a2, d5h74b1, d5h74b2, d5h74c1, d5h74c2, d5h74d1, d5h74d2, d5h74e_, d5h74f2, d5h74f3
    automated match to d3tiia1
    complexed with 7lg, acp, ca, gdp, gtp, mes, mg

Details for d5h74f1

PDB Entry: 5h74 (more details), 2.6 Å

PDB Description: crystal structure of t2r-ttl-14b complex
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5h74f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h74f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5h74f1:

Click to download the PDB-style file with coordinates for d5h74f1.
(The format of our PDB-style files is described here.)

Timeline for d5h74f1:

  • d5h74f1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24