Lineage for d5h6zb1 (5h6z B:1-114)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2073020Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2073097Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2073098Protein automated matches [226914] (2 species)
    not a true protein
  7. 2298500Species Schizosaccharomyces pombe [TaxId:284812] [341801] (1 PDB entry)
  8. 2298501Domain d5h6zb1: 5h6z B:1-114 [341802]
    Other proteins in same PDB: d5h6zb2
    automated match to d3kmta_
    complexed with nh4, peg, so4

Details for d5h6zb1

PDB Entry: 5h6z (more details), 2 Å

PDB Description: crystal structure of set7, a novel histone methyltransferase in schizossacharomyces pombe
PDB Compounds: (B:) SET domain-containing protein 7

SCOPe Domain Sequences for d5h6zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h6zb1 b.85.7.0 (B:1-114) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqytvlneyt
yvwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcis

SCOPe Domain Coordinates for d5h6zb1:

Click to download the PDB-style file with coordinates for d5h6zb1.
(The format of our PDB-style files is described here.)

Timeline for d5h6zb1:

  • d5h6zb1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5h6zb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5h6za_