Lineage for d5gvtb_ (5gvt B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057491Protein automated matches [190044] (14 species)
    not a true protein
  7. 2057696Species Mouse (Mus musculus) [TaxId:10090] [188816] (4 PDB entries)
  8. 2298499Domain d5gvtb_: 5gvt B: [341800]
    automated match to d2anwa_
    complexed with bma, man

Details for d5gvtb_

PDB Entry: 5gvt (more details), 2.61 Å

PDB Description: crystal structures of the serine protease domain of murine plasma kallikrein
PDB Compounds: (B:) Plasma kallikrein

SCOPe Domain Sequences for d5gvtb_:

Sequence, based on SEQRES records: (download)

>d5gvtb_ b.47.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivggtnaslgewpwqvslqvklvsqthlcggsiigrqwvltaahcfdgipypdvwriygg
ilslseitketpssrikeliihqeykvsegnydialiklqtplnytefqkpislpskadt
ntiytncwvtgwgytkeqgetqnilqkatiplvpneecqkkyrdyvinkqmicagykegg
tdackgdsggplvckhsgrwqlvgitswgegcarkdqpgvytkvseymdwilektq

Sequence, based on observed residues (ATOM records): (download)

>d5gvtb_ b.47.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivggtnaslgewpwqvslqvklvsqthlcggsiigrqwvltaahcfdgipypdvwriygg
ilslseitketpssrikeliihqeykvsegnydialiklqtplnytefqkpislpsntiy
tncwvtgwgytkeetqnilqkatiplvpneecqkvinkqmicagykeggtdackgdsggp
lvckhsgrwqlvgitswgegcarkdqpgvytkvseymdwilektq

SCOPe Domain Coordinates for d5gvtb_:

Click to download the PDB-style file with coordinates for d5gvtb_.
(The format of our PDB-style files is described here.)

Timeline for d5gvtb_:

  • d5gvtb_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24