Lineage for d6bk7b1 (6bk7 B:1-280)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2298491Species Enterococcus faecalis [TaxId:226185] [341792] (1 PDB entry)
  8. 2298493Domain d6bk7b1: 6bk7 B:1-280 [341794]
    Other proteins in same PDB: d6bk7a2, d6bk7b2
    automated match to d1efga2
    complexed with na

Details for d6bk7b1

PDB Entry: 6bk7 (more details), 1.83 Å

PDB Description: 1.83 angstrom resolution crystal structure of n-terminal fragment (residues 1-404) of elongation factor g from enterococcus faecalis
PDB Compounds: (B:) Elongation factor G

SCOPe Domain Sequences for d6bk7b1:

Sequence, based on SEQRES records: (download)

>d6bk7b1 c.37.1.0 (B:1-280) automated matches {Enterococcus faecalis [TaxId: 226185]}
marefslektrnigimahvdagktttterilyytgkihkigethegasqmdwmeqeqerg
ititsaattaqwkgyrvniidtpghvdftievqrslrvldgavtvldsqsgvepqtetvw
rqateykvprivfcnkmdkigadffysveslhdrlqanahpiqipigaeedftgiidlik
mkaeiytndlgtdiqetdipedylekaqewreklveavaetdedlmmkylegeeiteeel
vagirqatinveffpvlagsafknkgvqlmldavldylps

Sequence, based on observed residues (ATOM records): (download)

>d6bk7b1 c.37.1.0 (B:1-280) automated matches {Enterococcus faecalis [TaxId: 226185]}
marefslektrnigimahvdagktttterilyytgkititsaattaqwkgyrvniidtpg
hvdftievqrslrvldgavtvldsqsgvepqtetvwrqateykvprivfcnkmdkigadf
fysveslhdrlqanahpiqipigaeedftgiidlikmkaeiytndlgtdiqetdipedyl
ekaqewreklveavaetdedlmmkylegeeiteeelvagirqatinveffpvlagsafkn
kgvqlmldavldylps

SCOPe Domain Coordinates for d6bk7b1:

Click to download the PDB-style file with coordinates for d6bk7b1.
(The format of our PDB-style files is described here.)

Timeline for d6bk7b1:

  • d6bk7b1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d6bk7b2