Lineage for d6b8sa1 (6b8s A:3-348)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (21 species)
    not a true protein
  7. 2298473Species Helicobacter pylori [TaxId:563041] [341774] (1 PDB entry)
  8. 2298478Domain d6b8sa1: 6b8s A:3-348 [341779]
    Other proteins in same PDB: d6b8sa2, d6b8sb2
    automated match to d4rlia_
    complexed with fmn, pge

Details for d6b8sa1

PDB Entry: 6b8s (more details), 2.25 Å

PDB Description: crystal structure of dihydroorotate dehydrogenase from helicobacter pylori with bound fmn
PDB Compounds: (A:) Dihydroorotate dehydrogenase (quinone)

SCOPe Domain Sequences for d6b8sa1:

Sequence, based on SEQRES records: (download)

>d6b8sa1 c.1.4.0 (A:3-348) automated matches {Helicobacter pylori [TaxId: 563041]}
yplvkkylfsldaedahekvckilrtlskssflcslihsqwgyknpkleneilglnfpnp
lglaagfdknasmlraliafgfgyleagtltneaqvgnerprlfrhieeeslqnamgfnn
ygavlgarsfnrfapyktpiginlgknkhieqahaledykavlnqclnigdyytfnlssp
ntpnlrdlqnkafvnelfcmakemthkplflkiapdleiddmleivnsaieagahgiiat
nttidkslvfapkemgglsgkcltkksrevfkelakaffnksvlvsvggisdakeayeri
kmgasllqiysafiyngpnlcqnilkdlvkllqkdgflsvkeaiga

Sequence, based on observed residues (ATOM records): (download)

>d6b8sa1 c.1.4.0 (A:3-348) automated matches {Helicobacter pylori [TaxId: 563041]}
yplvkkylfsldaedahekvckilrtlskssflcslihsqwgyknpkleneilglnfpnp
lglaagfdknasmlraliafgfgyleagtltneaqvgnerprlfrhieeeslqnamgfnn
ygavlgarsfnrfapyktpiginlgknkhieqahaledykavlnqclnigdyytfnlnka
fvnelfcmakemthkplflkiapdleiddmleivnsaieagahgiiatnttidkslvfap
kemgglsgkcltkksrevfkelakaffnksvlvsvggisdakeayerikmgasllqiysa
fiyngpnlcqnilkdlvkllqkdgflsvkeaiga

SCOPe Domain Coordinates for d6b8sa1:

Click to download the PDB-style file with coordinates for d6b8sa1.
(The format of our PDB-style files is described here.)

Timeline for d6b8sa1:

  • d6b8sa1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d6b8sa2