Lineage for d6blga_ (6blg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2298476Species Klebsiella pneumoniae [TaxId:272620] [341777] (1 PDB entry)
  8. 2298477Domain d6blga_: 6blg A: [341778]
    automated match to d4piwb_
    complexed with cl, edo, fmt, mes, so4

Details for d6blga_

PDB Entry: 6blg (more details), 2.1 Å

PDB Description: crystal structure of sugar transaminase from klebsiella pneumoniae complexed with plp
PDB Compounds: (A:) dTDP-4-amino-4,6-dideoxygalactose transaminase

SCOPe Domain Sequences for d6blga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6blga_ c.67.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mipfnappvvgteldymqsamnsgklcgdggftrrcqqwmeqrfgtakalltpsctasle
maallldiqpgdevimpsytfvstanafvlrgakivfvdirrdtmnidetlieaaitdkt
raivpvhyagvacemdtimaiadkynlfvvedaaqgvmstykgralgtighigcfsfhet
knytaggeggatlindrtlveraeiirekgtnrsqffrglvdkytwrdigssylmsdlqa
aylwaqleaaerinqqrlalwqnyydallplaragrielptvpadcgqnahmfyiklrdi
edrsrliawlkeaeilavfhyiplhscpageqfgefrgedryttqeserlvrlplfynls
vvnqrtvinsllsyfs

SCOPe Domain Coordinates for d6blga_:

Click to download the PDB-style file with coordinates for d6blga_.
(The format of our PDB-style files is described here.)

Timeline for d6blga_:

  • d6blga_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24