![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
![]() | Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) ![]() |
![]() | Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
![]() | Protein automated matches [191011] (16 species) not a true protein |
![]() | Species Vaccinia virus [TaxId:10245] [256246] (5 PDB entries) |
![]() | Domain d6b9jx1: 6b9j X:2-235 [341776] Other proteins in same PDB: d6b9jb1, d6b9jb2, d6b9jl1, d6b9jl2, d6b9jx2, d6b9jy2 automated match to d4etqx_ complexed with gol, na |
PDB Entry: 6b9j (more details), 2.9 Å
SCOPe Domain Sequences for d6b9jx1:
Sequence, based on SEQRES records: (download)
>d6b9jx1 b.74.1.0 (X:2-235) automated matches {Vaccinia virus [TaxId: 10245]} pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav wiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysg
>d6b9jx1 b.74.1.0 (X:2-235) automated matches {Vaccinia virus [TaxId: 10245]} pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav wiifptpinihsdqlskfrtllslhyitenyrnpyklnddtevyysg
Timeline for d6b9jx1: