Lineage for d6ayca1 (6ayc A:37-483)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2298470Species Naegleria gruberi [TaxId:5762] [341771] (1 PDB entry)
  8. 2298471Domain d6ayca1: 6ayc A:37-483 [341772]
    Other proteins in same PDB: d6ayca2
    automated match to d3gw9a_
    complexed with 1yn, hem

Details for d6ayca1

PDB Entry: 6ayc (more details), 2.6 Å

PDB Description: naegleria fowleri cyp51-itraconazole complex
PDB Compounds: (A:) Obtusifoliol 14alpha-demethylase

SCOPe Domain Sequences for d6ayca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ayca1 a.104.1.0 (A:37-483) automated matches {Naegleria gruberi [TaxId: 5762]}
pprvpnlipyvgsfvsfaknpvqfiidnskkygdvftatilgkemtflnhpkildtffka
tdnelslrdvyrfmrpvfgtgvvydadstermmeqvkfvssglttarfrvfvdifedeia
hkvkelgpegtvdvaelmadliiftasrcllgdevrqylseknlgklyhdiddgisplsf
fypslpapkrdkarkavgeifqelldkrreehkkhperlldeskmdvvdhlltqkykdgq
eltdvhrigiliaglfagqhtssitsswtlmnvisnkkvlekvrkeqeeimgsdkvldyd
kvmkmdyleacmkealrmypplimimrmarkpreceqyiipkgnilvvspsvagrctdty
tnpdvfdperlterkehekfkygavpfgagrhkcigenfallqvksiisillryfdmeyi
gkipdpsytslvvgpspptrmryklrk

SCOPe Domain Coordinates for d6ayca1:

Click to download the PDB-style file with coordinates for d6ayca1.
(The format of our PDB-style files is described here.)

Timeline for d6ayca1:

  • d6ayca1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d6ayca2