Lineage for d6b9jy1 (6b9j Y:2-235)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2068693Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2068694Protein automated matches [191011] (13 species)
    not a true protein
  7. 2068792Species Vaccinia virus [TaxId:10245] [256246] (6 PDB entries)
  8. 2298464Domain d6b9jy1: 6b9j Y:2-235 [341765]
    Other proteins in same PDB: d6b9jb1, d6b9jb2, d6b9jl1, d6b9jl2, d6b9jx2, d6b9jy2
    automated match to d4etqx_
    complexed with gol, na

Details for d6b9jy1

PDB Entry: 6b9j (more details), 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv138
PDB Compounds: (Y:) IMV membrane protein

SCOPe Domain Sequences for d6b9jy1:

Sequence, based on SEQRES records: (download)

>d6b9jy1 b.74.1.0 (Y:2-235) automated matches {Vaccinia virus [TaxId: 10245]}
pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
wiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysg

Sequence, based on observed residues (ATOM records): (download)

>d6b9jy1 b.74.1.0 (Y:2-235) automated matches {Vaccinia virus [TaxId: 10245]}
pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
wiifptpinihsdqlskfrtllslhyitenyrnpyklnddtevyysg

SCOPe Domain Coordinates for d6b9jy1:

Click to download the PDB-style file with coordinates for d6b9jy1.
(The format of our PDB-style files is described here.)

Timeline for d6b9jy1:

  • d6b9jy1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24