Lineage for d6bgma_ (6bgm A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070498Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 protein domains)
    Pfam PF05995, CDO_I
  6. 2070499Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2070500Species Human (Homo sapiens) [TaxId:9606] [159290] (2 PDB entries)
    Uniprot Q16878 6-190
  8. 2298463Domain d6bgma_: 6bgm A: [341764]
    automated match to d3elna_
    complexed with fe2, gol, so4

Details for d6bgma_

PDB Entry: 6bgm (more details), 2.21 Å

PDB Description: crystal structure of ferrous form of the matured human cysteine dioxygenase
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d6bgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bgma_ b.82.1.19 (A:) Cysteine dioxygenase type I {Human (Homo sapiens) [TaxId: 9606]}
vlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytrnlvdq
gngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkkservl
renqcayindsvglhrvenishtepavslhlysppfdtchafdqrtghknkvtmtfhskf
girtpna

SCOPe Domain Coordinates for d6bgma_:

Click to download the PDB-style file with coordinates for d6bgma_.
(The format of our PDB-style files is described here.)

Timeline for d6bgma_:

  • d6bgma_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24