SCOPe 2.06: Domain d6b4nb_: 6b4n B:

Lineage for d6b4nb_ (6b4n B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (476 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d6b4nb_: 6b4n B: [341763]
   automated match to d1sdta_
   complexed with cl, g53, na

Details for d6b4nb_

PDB Entry: 6b4n, 1.3 Å

PDB Description: a hydroxymethyl functionality at the 4-position of the 2-phenyloxazole moiety of hiv-1 protease inhibitors involving the p2' ligands

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d6b4nb_:

Sequence; same for both SEQRES and ATOM records:

>d6b4nb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d6b4nb_:

• d6b4nb_ is new in SCOPe 2.06-stable
  
• d6b4nb_ appears in SCOPe 2.07
  
• d6b4nb_ appears in the current release, SCOPe 2.08