Lineage for d5vx1a1 (5vx1 A:23-183)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2223824Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2223896Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2224146Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 2224147Protein automated matches [195066] (3 species)
    not a true protein
  7. 2224148Species Human (Homo sapiens) [TaxId:9606] [225196] (10 PDB entries)
  8. 2298459Domain d5vx1a1: 5vx1 A:23-183 [341760]
    Other proteins in same PDB: d5vx1a2, d5vx1b2
    automated match to d2imta_

Details for d5vx1a1

PDB Entry: 5vx1 (more details), 1.22 Å

PDB Description: bak l100a
PDB Compounds: (A:) bcl-2 homologous antagonist/killer

SCOPe Domain Sequences for d5vx1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vx1a1 f.1.4.0 (A:23-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrqlaiig
ddinrrydsefqtmlqhaqptaenayeyftkiatslfesginwgrvvallgfgyrlalhv
yqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaalnl

SCOPe Domain Coordinates for d5vx1a1:

Click to download the PDB-style file with coordinates for d5vx1a1.
(The format of our PDB-style files is described here.)

Timeline for d5vx1a1:

  • d5vx1a1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-18

View in 3D
Domains from same chain:
(mouse over for more information)
d5vx1a2