Lineage for d5o1ka_ (5o1k A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978471Protein Neuroglobin [100978] (2 species)
  7. 1978479Species Mouse (Mus musculus) [TaxId:10090] [109625] (28 PDB entries)
    Uniprot Q9ER97
  8. 2298457Domain d5o1ka_: 5o1k A: [341758]
    automated match to d4nzia_
    complexed with dio, hem, so4, xe; mutant

Details for d5o1ka_

PDB Entry: 5o1k (more details), 2.05 Å

PDB Description: crystal structure of murine neuroglobin mutant v140w under 20 bar xenon pressure
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d5o1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o1ka_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygawvqamsrgwdg

SCOPe Domain Coordinates for d5o1ka_:

Click to download the PDB-style file with coordinates for d5o1ka_.
(The format of our PDB-style files is described here.)

Timeline for d5o1ka_:

  • d5o1ka_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-17