Lineage for d5wpib_ (5wpi B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213803Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2213804Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2213947Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2213948Protein automated matches [190175] (9 species)
    not a true protein
  7. 2213963Species Erwinia amylovora [TaxId:552] [341718] (1 PDB entry)
  8. 2213965Domain d5wpib_: 5wpi B: [341746]
    automated match to d1jdwa_
    complexed with edo

Details for d5wpib_

PDB Entry: 5wpi (more details), 2.3 Å

PDB Description: the virulence-associated protein hsva from the fire blight pathogen erwinia amylovora is a polyamine amidinotransferase
PDB Compounds: (B:) HsvA

SCOPe Domain Sequences for d5wpib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wpib_ d.126.1.0 (B:) automated matches {Erwinia amylovora [TaxId: 552]}
yqkeepsyfshspspvevytewdpleevivgimddirvpdwdkslkaiipeenhdffqty
sgkrfpeellikarqevetlaqilqaegirvkrpnesnhhqpimtphfttggtfysampr
dclfaigkkiievpmswrsryfetfafrdilndyftrgaewiaapkpmlsddvwekdfdf
eqefpfrsiiteveplfdaadfmkmgrdiigqrshatnkkgiewlrrtlgpdyhihiyef
depapmhidttilplapgrvlinkgwvpqipdifkdweilnppasnlpddhplymssnwi
htnvlmldektviveedeealisafrqwgfktilcpfkhfqtfggsfhcatldvkrsgsl
ksyi

SCOPe Domain Coordinates for d5wpib_:

Click to download the PDB-style file with coordinates for d5wpib_.
(The format of our PDB-style files is described here.)

Timeline for d5wpib_: