Lineage for d5orfc3 (5orf C:388-583)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336647Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2336648Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2337021Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2337022Protein automated matches [254493] (6 species)
    not a true protein
  7. 2337197Species Sheep (Ovis aries) [TaxId:9940] [259659] (3 PDB entries)
  8. 2337212Domain d5orfc3: 5orf C:388-583 [341731]
    automated match to d1n5ua3
    complexed with peg, pge, pro

Details for d5orfc3

PDB Entry: 5orf (more details), 2.54 Å

PDB Description: structure of ovine serum albumin in p1 space group
PDB Compounds: (C:) serum albumin

SCOPe Domain Sequences for d5orfc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5orfc3 a.126.1.0 (C:388-583) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
kkncelfekhgeygfqnalivrytrkapqvstptlveisrslgkvgtkccakpesermpc
tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsdltldetyvpkpfdekfft
fhadictlpdtekqikkqtalvellkhkpkatdeqlktvmenfvafvdkccaaddkegcf
vlegpklvastqaala

SCOPe Domain Coordinates for d5orfc3:

Click to download the PDB-style file with coordinates for d5orfc3.
(The format of our PDB-style files is described here.)

Timeline for d5orfc3: