SCOPe 2.06: Domain d1cddb_: 1cdd B:

Lineage for d1cddb_ (1cdd B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)

8. Domain d1cddb_: 1cdd B: [34173]
   complexed with po4

Details for d1cddb_

PDB Entry: 1cdd, 2.8 Å

PDB Description: structures of apo and complexed escherichia coli glycinamide ribonucleotide transformylase

PDB Compounds: (B:) phosphoribosyl-glycinamide formyltransferase

SCOPe Domain Sequences for d1cddb_:

Sequence, based on SEQRES records:

>d1cddb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgyaade

Sequence, based on observed residues (ATOM records):

>d1cddb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpgtsvhfvtdel
dggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhenaawldgqrl
ppqgyaade

Timeline for d1cddb_:

• d1cddb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cddb_ appears in SCOPe 2.05
  
• d1cddb_ appears in SCOPe 2.07
  
• d1cddb_ appears in the current release, SCOPe 2.08