Lineage for d5yn4a_ (5yn4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126575Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2126589Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2126590Protein automated matches [193326] (10 species)
    not a true protein
  7. 2126591Species Acinetobacter baumannii [TaxId:575584] [196867] (16 PDB entries)
  8. 2298421Domain d5yn4a_: 5yn4 A: [341722]
    automated match to d4qaja_

Details for d5yn4a_

PDB Entry: 5yn4 (more details), 1.47 Å

PDB Description: crystal structure of dimeric peptidyl trna hydrolase from acinetobacter baumannii with occluded substrate binding site at 1.47 a resolution
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5yn4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yn4a_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

SCOPe Domain Coordinates for d5yn4a_:

Click to download the PDB-style file with coordinates for d5yn4a_.
(The format of our PDB-style files is described here.)

Timeline for d5yn4a_:

  • d5yn4a_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-17

View in 3D
Domains from other chains:
(mouse over for more information)
d5yn4b_