Lineage for d5x7ka_ (5x7k A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2298419Species Serratia marcescens [TaxId:615] [341720] (1 PDB entry)
  8. 2298420Domain d5x7ka_: 5x7k A: [341721]
    automated match to d4hzia_

Details for d5x7ka_

PDB Entry: 5x7k (more details), 2.65 Å

PDB Description: crystal structure of the nucleotide-binding domain (nbd) of lipb, a abc transporter subunit of a type i secretion system
PDB Compounds: (A:) lipase b

SCOPe Domain Sequences for d5x7ka_:

Sequence, based on SEQRES records: (download)

>d5x7ka_ c.37.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
mslprpegvlsvegvtatppgskgdavlhnvsfaiqpgdvlgiigpsasgkstlarllvg
iwpvsegivrldnadiyqwnkdelgpyigylpqdielfagtiaeniarfndidsekviea
aklagvhelilrfpngydsvignggaglsggqkqriglaralygdpalvvldepnsnldd
agekalnqaimflkqrnktvvlithrtnllsmtskllllvngnvnafgptqqvlqalana
qka

Sequence, based on observed residues (ATOM records): (download)

>d5x7ka_ c.37.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
mslprpegvlsvegvtatppvlhnvsfaiqpgdvlgiigpsasgkstlarllvgiwpvse
givrldnadiyqwnkdelgpyigylpqdielfagtiaeniarfndidsekvieaaklagv
helilrfpngydsvignggaglsggqkqriglaralygdpalvvldepnsnlddagekal
nqaimflkqrnktvvlithrtnllsmtskllllvngnvnafgptqqvlqalanaqka

SCOPe Domain Coordinates for d5x7ka_:

Click to download the PDB-style file with coordinates for d5x7ka_.
(The format of our PDB-style files is described here.)

Timeline for d5x7ka_:

  • d5x7ka_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-17

View in 3D
Domains from other chains:
(mouse over for more information)
d5x7kb_