Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (7 species) not a true protein |
Species Sus barbatus [TaxId:41807] [278811] (7 PDB entries) |
Domain d5yl4d1: 5yl4 D:1-243 [341705] Other proteins in same PDB: d5yl4a2, d5yl4b2, d5yl4c2, d5yl4d2, d5yl4e_, d5yl4f1, d5yl4f2 automated match to d4drxb1 complexed with 8wr, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5yl4 (more details), 2.64 Å
SCOPe Domain Sequences for d5yl4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yl4d1 c.32.1.1 (D:1-243) automated matches {Sus barbatus [TaxId: 41807]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d5yl4d1: