SCOPe 2.06: Domain d5yl4d1: 5yl4 D:1-243

Lineage for d5yl4d1 (5yl4 D:1-243)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Sus barbatus [TaxId:41807] [278811] (7 PDB entries)

8. Domain d5yl4d1: 5yl4 D:1-243 [341705]
   Other proteins in same PDB: d5yl4a2, d5yl4b2, d5yl4c2, d5yl4d2, d5yl4e_, d5yl4f1, d5yl4f2
   automated match to d4drxb1
   complexed with 8wr, acp, ca, gdp, gtp, mes, mg

Details for d5yl4d1

PDB Entry: 5yl4, 2.64 Å

PDB Description: crystal structure of t2r-ttl-8wr complex

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5yl4d1:

Sequence; same for both SEQRES and ATOM records:

>d5yl4d1 c.32.1.1 (D:1-243) automated matches {Sus barbatus [TaxId: 41807]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d5yl4d1:

• d5yl4d1 is new in SCOPe 2.06-stable
  
• d5yl4d1 appears in SCOPe 2.07
  
• d5yl4d1 appears in the current release, SCOPe 2.08