Lineage for d1grca_ (1grc A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704461Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 704462Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 704463Family c.65.1.1: Formyltransferase [53329] (4 proteins)
  6. 704470Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 704471Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)
  8. 704484Domain d1grca_: 1grc A: [34170]

Details for d1grca_

PDB Entry: 1grc (more details), 3 Å

PDB Description: crystal structure of glycinamide ribonucleotide transformylase from escherichia coli at 3.0 angstroms resolution: a target enzyme for chemotherapy
PDB Compounds: (A:) glycinamide ribonucleotide transformylase

SCOP Domain Sequences for d1grca_:

Sequence, based on SEQRES records: (download)

>d1grca_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

Sequence, based on observed residues (ATOM records): (download)

>d1grca_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpdeehgts
vhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhena
awldgqrlppqgya

SCOP Domain Coordinates for d1grca_:

Click to download the PDB-style file with coordinates for d1grca_.
(The format of our PDB-style files is described here.)

Timeline for d1grca_: