Lineage for d6auda4 (6aud A:726-1091)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195572Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 2195573Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2195574Species Human (Homo sapiens) [TaxId:9606] [56174] (65 PDB entries)
  8. 2298394Domain d6auda4: 6aud A:726-1091 [341695]
    Other proteins in same PDB: d6auda1, d6auda2, d6auda3, d6auda5
    automated match to d1he8a4
    complexed with bwy

Details for d6auda4

PDB Entry: 6aud (more details), 2.02 Å

PDB Description: pi3k-gamma k802t in complex with cpd 8 10-((1-(tert-butyl)piperidin-4- yl)sulfinyl)-2-(1-isopropyl-1h-1,2,4-triazol-5-yl)-5,6- dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepine
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d6auda4:

Sequence, based on SEQRES records: (download)

>d6auda4 d.144.1.4 (A:726-1091) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekctvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wflhlv

Sequence, based on observed residues (ATOM records): (download)

>d6auda4 d.144.1.4 (A:726-1091) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekctvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghiervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmt
gmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlv

SCOPe Domain Coordinates for d6auda4:

Click to download the PDB-style file with coordinates for d6auda4.
(The format of our PDB-style files is described here.)

Timeline for d6auda4:

  • d6auda4 appears in periodic updates to SCOPe 2.06 starting on 2017-11-17