Lineage for d6auda3 (6aud A:525-725)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006533Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
  6. 2006534Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2006535Species Human (Homo sapiens) [TaxId:9606] [48402] (65 PDB entries)
  8. 2298393Domain d6auda3: 6aud A:525-725 [341694]
    Other proteins in same PDB: d6auda1, d6auda2, d6auda4, d6auda5
    automated match to d1e8ya1
    complexed with bwy

Details for d6auda3

PDB Entry: 6aud (more details), 2.02 Å

PDB Description: pi3k-gamma k802t in complex with cpd 8 10-((1-(tert-butyl)piperidin-4- yl)sulfinyl)-2-(1-isopropyl-1h-1,2,4-triazol-5-yl)-5,6- dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepine
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d6auda3:

Sequence, based on SEQRES records: (download)

>d6auda3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d6auda3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpiaempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqq
eivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyll
qlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileayl
rgcg

SCOPe Domain Coordinates for d6auda3:

Click to download the PDB-style file with coordinates for d6auda3.
(The format of our PDB-style files is described here.)

Timeline for d6auda3:

  • d6auda3 appears in periodic updates to SCOPe 2.06 starting on 2017-11-17