Lineage for d6auda2 (6aud A:357-522)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038040Family b.7.1.1: PLC-like (P variant) [49563] (12 protein domains)
  6. 2038063Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 2038064Species Human (Homo sapiens) [TaxId:9606] [49572] (61 PDB entries)
  8. 2298392Domain d6auda2: 6aud A:357-522 [341693]
    Other proteins in same PDB: d6auda1, d6auda3, d6auda4, d6auda5
    automated match to d1he8a2
    complexed with bwy

Details for d6auda2

PDB Entry: 6aud (more details), 2.02 Å

PDB Description: pi3k-gamma k802t in complex with cpd 8 10-((1-(tert-butyl)piperidin-4- yl)sulfinyl)-2-(1-isopropyl-1h-1,2,4-triazol-5-yl)-5,6- dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepine
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d6auda2:

Sequence, based on SEQRES records: (download)

>d6auda2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d6auda2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatn
pdkensmsisilldn

SCOPe Domain Coordinates for d6auda2:

Click to download the PDB-style file with coordinates for d6auda2.
(The format of our PDB-style files is described here.)

Timeline for d6auda2:

  • d6auda2 appears in periodic updates to SCOPe 2.06 starting on 2017-11-17