Lineage for d5wkpa1 (5wkp A:56-455)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131631Protein automated matches [190399] (9 species)
    not a true protein
  7. 2131644Species Human (Homo sapiens) [TaxId:9606] [189951] (14 PDB entries)
  8. 2298388Domain d5wkpa1: 5wkp A:56-455 [341689]
    Other proteins in same PDB: d5wkpa2, d5wkpc_, d5wkpd_, d5wkpe2, d5wkpg_, d5wkph_
    automated match to d3lvma_
    complexed with 8q1, plp

Details for d5wkpa1

PDB Entry: 5wkp (more details), 3.15 Å

PDB Description: crystal structure of the human mitochondrial cysteine desulfurase in complex with isd11 and iron-sulfur cluster scaffold protein iscu1, and e. coli acp1 protein at 3.15a
PDB Compounds: (A:) Cysteine desulfurase, mitochondrial

SCOPe Domain Sequences for d5wkpa1:

Sequence, based on SEQRES records: (download)

>d5wkpa1 c.67.1.3 (A:56-455) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrplymdvqattpldprvldamlpylinyygnphsrthaygweseaamerarqqvaslig
adpreiiftsgatesnniaikgvarfyrsrkkhlittqtehkcvldscrsleaegfqvty
lpvqksgiidlkeleaaiqpdtslvsvmtvnneigvkqpiaeigricssrkvyfhtdaaq
avgkipldvndmkidlmsisghkiygpkgvgaiyirrrprvrvealqsgggqergmrsgt
vptplvvglgaacevaqqemeydhkrisklserliqnimkslpdvvmngdpkhhypgcin
lsfayvegesllmalkdvalssgsactsaslepsyvlraigtdedlahssirfgigrftt
eeevdytvekciqhvkrlremsplwemvqdgidlksikwt

Sequence, based on observed residues (ATOM records): (download)

>d5wkpa1 c.67.1.3 (A:56-455) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrplymdvqattpldprvldamlpylinyygnphsrthaygweseaamerarqqvaslig
adpreiiftsgatesnniaikgvarfyrsrkkhlittqtehkcvldscrsleaegfqvty
lpvqksgiidlkeleaaiqpdtslvsvmtvnneigvkqpiaeigricssrkvyfhtdaaq
avgkipldvndmkidlmsisghkiygpkgvgaiyirrrprvrvealqsgggqergmrsgt
vptplvvglgaacevaqqemeydhkrisklserliqnimkslpdvvmngdpkhhypgcin
lsfayvegesllmalkdvalssgsalepsyvlraigtdedlahssirfgigrftteeevd
ytvekciqhvkrlremsplwemvqdgidlksikwt

SCOPe Domain Coordinates for d5wkpa1:

Click to download the PDB-style file with coordinates for d5wkpa1.
(The format of our PDB-style files is described here.)

Timeline for d5wkpa1:

  • d5wkpa1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-17