Lineage for d5u4rb1 (5u4r B:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2298383Domain d5u4rb1: 5u4r B:1-106 [341684]
    Other proteins in same PDB: d5u4rb2, d5u4rl2
    automated match to d1dn0a1

Details for d5u4rb1

PDB Entry: 5u4r (more details), 1.76 Å

PDB Description: crystal structure of the broadly neutralizing influenza a antibody vrc 315 53-1a09 fab.
PDB Compounds: (B:) VRC 315 53-1A09 Fab Light chain

SCOPe Domain Sequences for d5u4rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u4rb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqrirnylnwyqqkpgrapklliytasklqggvps
rfsgsgsgtdftltinslqpedfatyycqqshetpltfgqgtkiev

SCOPe Domain Coordinates for d5u4rb1:

Click to download the PDB-style file with coordinates for d5u4rb1.
(The format of our PDB-style files is described here.)

Timeline for d5u4rb1:

  • d5u4rb1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5u4rb2