Lineage for d1c2tb_ (1c2t B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864352Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 1864353Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 1864354Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 1864361Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 1864362Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)
  8. 1864372Domain d1c2tb_: 1c2t B: [34168]
    complexed with gar, nhs

Details for d1c2tb_

PDB Entry: 1c2t (more details), 2.1 Å

PDB Description: new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid.
PDB Compounds: (B:) glycinamide ribonucleotide transformylase

SCOPe Domain Sequences for d1c2tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2tb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

SCOPe Domain Coordinates for d1c2tb_:

Click to download the PDB-style file with coordinates for d1c2tb_.
(The format of our PDB-style files is described here.)

Timeline for d1c2tb_: