Lineage for d5y1fa1 (5y1f A:1-308)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2849222Species Uncultured archaeon [TaxId:743092] [341638] (4 PDB entries)
  8. 2849223Domain d5y1fa1: 5y1f A:1-308 [341676]
    Other proteins in same PDB: d5y1fa2
    automated match to d3wmxa_
    complexed with nad

Details for d5y1fa1

PDB Entry: 5y1f (more details), 1.25 Å

PDB Description: monomeric l-threonine 3-dehydrogenase from metagenome database (nad+ bound form)
PDB Compounds: (A:) NAD dependent epimerase/dehydratase family

SCOPe Domain Sequences for d5y1fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y1fa1 c.2.1.0 (A:1-308) automated matches {Uncultured archaeon [TaxId: 743092]}
milvtgalgqigtelvlalqekygndkiiasdlkepenyhckfekcdirdietyerinne
nkieivyhlaailsaageknpelchdvnynglenvlktakkynqklfcpssiavfgpdvp
kemtpqnvelnpktvygitkvkgeelcdtyfkehgidvrgirypgliswkhkpsggttdy
avemyfdavesgkyecfvnrntrlpmmfmddairatlelmdapldslnyhsnynlssmsf
saeelekeisahvdfnclykpdyrqdiadtwpisindddarkdwgwepkfdiskmteemi
tnlrrlne

SCOPe Domain Coordinates for d5y1fa1:

Click to download the PDB-style file with coordinates for d5y1fa1.
(The format of our PDB-style files is described here.)

Timeline for d5y1fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y1fa2