SCOPe 2.06: Domain d5wbta_: 5wbt A:

Lineage for d5wbta_ (5wbt A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56998] (61 PDB entries)
   Uniprot P01308

8. Domain d5wbta_: 5wbt A: [341669]
   automated match to d1efea_

Details for d5wbta_

PDB Entry: 5wbt

PDB Description: solution structure and dynamics of an ultra-stable single-chain insulin analog studies of an engineered monomer and implications for receptor binding

PDB Compounds: (A:) insulin

SCOPe Domain Sequences for d5wbta_:

Sequence; same for both SEQRES and ATOM records:

>d5wbta_ g.1.1.1 (A:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytdpteegprrgiveqcchsicsleqlenycn

Timeline for d5wbta_:

• d5wbta_ is new in SCOPe 2.06-stable
  
• d5wbta_ appears in SCOPe 2.07
  
• d5wbta_ appears in the current release, SCOPe 2.08