SCOPe 2.06: Domain d5v94b_: 5v94 B:

Lineage for d5v94b_ (5v94 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein automated matches [190299] (7 species)
   not a true protein

7. Species Anas platyrhynchos [TaxId:8839] [341650] (3 PDB entries)

8. Domain d5v94b_: 5v94 B: [341661]
   automated match to d2vb1a_
   complexed with mrd, po4, trs

Details for d5v94b_

PDB Entry: 5v94, 1.65 Å

PDB Description: pekin duck egg lysozyme isoform iii (del-iii), cubic form

PDB Compounds: (B:) lysozyme isoform III

SCOPe Domain Sequences for d5v94b_:

Sequence; same for both SEQRES and ATOM records:

>d5v94b_ d.2.1.2 (B:) automated matches {Anas platyrhynchos [TaxId: 8839]}
kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
rwwcddgktprsknacgircsvllrsditeavrcakrivrdgngmnawvawrnrcrgtdv
skwirgcrl

Timeline for d5v94b_:

• d5v94b_ is new in SCOPe 2.06-stable
  
• d5v94b_ appears in SCOPe 2.07
  
• d5v94b_ appears in the current release, SCOPe 2.08