Lineage for d5omxg_ (5omx G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2698678Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (11 PDB entries)
  8. 2698683Domain d5omxg_: 5omx G: [341660]
    Other proteins in same PDB: d5omxb_, d5omxd_, d5omxf_, d5omxh_
    automated match to d1eqza_
    complexed with cl, mn

Details for d5omxg_

PDB Entry: 5omx (more details), 2.32 Å

PDB Description: x-ray structure of the h2a-n38c nucleosome core particle
PDB Compounds: (G:) histone h2a

SCOPe Domain Sequences for d5omxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5omxg_ a.22.1.1 (G:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
trssraglqfpvgrvhrllrkgcyaervgagapvylaavleyltaeilelagnaardnkk
triiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

SCOPe Domain Coordinates for d5omxg_:

Click to download the PDB-style file with coordinates for d5omxg_.
(The format of our PDB-style files is described here.)

Timeline for d5omxg_: