Lineage for d4n3ew_ (4n3e W:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975906Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2975907Protein automated matches [190218] (21 species)
    not a true protein
  7. 2976021Species Hypericum perforatum [TaxId:65561] [189103] (4 PDB entries)
  8. 2976073Domain d4n3ew_: 4n3e W: [341658]
    automated match to d1e09a_
    complexed with 2an, epe, so4

Details for d4n3ew_

PDB Entry: 4n3e (more details), 2.43 Å

PDB Description: crystal structure of hyp-1, a st john's wort pr-10 protein, in complex with 8-anilino-1-naphthalene sulfonate (ans)
PDB Compounds: (W:) Phenolic oxidative coupling protein

SCOPe Domain Sequences for d4n3ew_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n3ew_ d.129.3.0 (W:) automated matches {Hypericum perforatum [TaxId: 65561]}
maaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvtkitfv
dghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgkitvty
hpkpgctvneeevkigekkayefykqveeylaanpevfa

SCOPe Domain Coordinates for d4n3ew_:

Click to download the PDB-style file with coordinates for d4n3ew_.
(The format of our PDB-style files is described here.)

Timeline for d4n3ew_: