Lineage for d5nj0a2 (5nj0 A:95-215)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Ethr repressor [109978] (2 species) Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
Uniprot P96222 22-215
Domain d5nj0a2: 5nj0 A:95-215 [341628]
Other proteins in same PDB: d5nj0a1
automated match to d1t56a2
protein/DNA complex; complexed with 8yw, so4
Details for d5nj0a2
PDB Entry: 5nj0 (more details), 2.1 Å
PDB Description: ethr complex
PDB Compounds: (A:) HTH-type transcriptional regulator EthRSCOPe Domain Sequences for d5nj0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nj0a2 a.121.1.1 (A:95-215) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n
SCOPe Domain Coordinates for d5nj0a2:
Click to download the PDB-style file with coordinates for d5nj0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5nj0a2:
- d5nj0a2 first appeared in SCOPe 2.06
- d5nj0a2 appears in SCOPe 2.07
View in 3D
