SCOPe 2.06: Domain d5tvhd1: 5tvh D:1-208

Lineage for d5tvhd1 (5tvh D:1-208)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species Aplysia californica [TaxId:6500] [324025] (4 PDB entries)

8. Domain d5tvhd1: 5tvh D:1-208 [341620]
   Other proteins in same PDB: d5tvha2, d5tvhb2, d5tvhc2, d5tvhd2, d5tvhe2
   automated match to d2w8gc_
   complexed with 7ko, dms, nag

Details for d5tvhd1

PDB Entry: 5tvh, 2.4 Å

PDB Description: crystal structure of achbp from aplysia californica complex with 2- aminopyrimidine at ph 8.0 spacegroup p21

PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5tvhd1:

Sequence; same for both SEQRES and ATOM records:

>d5tvhd1 b.96.1.0 (D:1-208) automated matches {Aplysia californica [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Timeline for d5tvhd1:

• d5tvhd1 is new in SCOPe 2.06-stable
  
• d5tvhd1 appears in SCOPe 2.07
  
• d5tvhd1 appears in the current release, SCOPe 2.08