Lineage for d5ngva_ (5ngv A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583547Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2583548Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2583778Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2583834Protein Type II activin receptor [57357] (3 species)
  7. 2583841Species Mouse (Mus musculus), isoform IIB [TaxId:10090] [111406] (3 PDB entries)
    Uniprot P27040 23-120; 100% sequence identity to the rat domain of the same type IIb (90154)
  8. 2583845Domain d5ngva_: 5ngv A: [341612]
    Other proteins in same PDB: d5ngvh1, d5ngvh2, d5ngvl1, d5ngvl2
    automated match to d2h64c_
    complexed with pg4

Details for d5ngva_

PDB Entry: 5ngv (more details), 2 Å

PDB Description: crystal structure of the activin receptor type-2b ligand binding domain in complex with bimagrumab fv, orthorhombic crystal form
PDB Compounds: (A:) Activin receptor type-2B

SCOPe Domain Sequences for d5ngva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ngva_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus), isoform IIB [TaxId: 10090]}
etreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfnc
ydrqecvateenpqvyfcccegnfcnerfthlp

SCOPe Domain Coordinates for d5ngva_:

Click to download the PDB-style file with coordinates for d5ngva_.
(The format of our PDB-style files is described here.)

Timeline for d5ngva_: