Lineage for d5veuk_ (5veu K:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (40 PDB entries)
  8. 2298296Domain d5veuk_: 5veu K: [341597]
    automated match to d1w0ea_
    complexed with hem, rit

Details for d5veuk_

PDB Entry: 5veu (more details), 2.91 Å

PDB Description: human cytochrome p450 3a5 (cyp3a5)
PDB Compounds: (K:) Cytochrome P450 3A5

SCOPe Domain Sequences for d5veuk_:

Sequence, based on SEQRES records: (download)

>d5veuk_ a.104.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
hrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyelathpd
vqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingv
fipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprncigmrf
almnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr

Sequence, based on observed residues (ATOM records): (download)

>d5veuk_ a.104.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
hrldflqlmidsqnalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqke
idavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsmv
viptyalhhdpkywtepeefrperfsdsidpyiytpfgtgprncigmrfalmnmklalir
vlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr

SCOPe Domain Coordinates for d5veuk_:

Click to download the PDB-style file with coordinates for d5veuk_.
(The format of our PDB-style files is described here.)

Timeline for d5veuk_:

  • d5veuk_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-17