Lineage for d5nima2 (5nim A:95-216)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Ethr repressor [109978] (2 species) Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
Uniprot P96222 22-215
Domain d5nima2: 5nim A:95-216 [341585]
Other proteins in same PDB: d5nima1
automated match to d1t56a2
protein/DNA complex; complexed with 8ye, so4
Details for d5nima2
PDB Entry: 5nim (more details), 1.5 Å
PDB Description: ethr complex
PDB Compounds: (A:) HTH-type transcriptional regulator EthRSCOPe Domain Sequences for d5nima2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nima2 a.121.1.1 (A:95-216) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
nr
SCOPe Domain Coordinates for d5nima2:
Click to download the PDB-style file with coordinates for d5nima2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5nima2:
- d5nima2 first appeared in SCOPe 2.06
- d5nima2 appears in SCOPe 2.07
View in 3D
