Lineage for d1b0pb4 (1b0p B:416-668)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125524Fold c.64: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53322] (1 superfamily)
  4. 125525Superfamily c.64.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53323] (1 family) (S)
  5. 125526Family c.64.1.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53324] (1 protein)
  6. 125527Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53325] (1 species)
  7. 125528Species Desulfovibrio africanus [TaxId:873] [53326] (3 PDB entries)
  8. 125532Domain d1b0pb4: 1b0p B:416-668 [34158]
    Other proteins in same PDB: d1b0pa1, d1b0pa2, d1b0pa3, d1b0pa5, d1b0pb1, d1b0pb2, d1b0pb3, d1b0pb5

Details for d1b0pb4

PDB Entry: 1b0p (more details), 2.31 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus

SCOP Domain Sequences for d1b0pb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0pb4 c.64.1.1 (B:416-668) Pyruvate-ferredoxin oxidoreductase, PFOR, domain III {Desulfovibrio africanus}
gtiqcqfwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpi
qstylvnradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtia
nkklkfynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkg
ekivkmntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklp
vsafeadgrfplg

SCOP Domain Coordinates for d1b0pb4:

Click to download the PDB-style file with coordinates for d1b0pb4.
(The format of our PDB-style files is described here.)

Timeline for d1b0pb4: