Lineage for d5nh3b_ (5nh3 B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259269Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2259392Protein automated matches [254536] (1 species)
    not a true protein
  7. 2259393Species Human (Homo sapiens) [TaxId:9606] [255202] (2 PDB entries)
  8. 2259396Domain d5nh3b_: 5nh3 B: [341579]
    Other proteins in same PDB: d5nh3h1, d5nh3h2, d5nh3i1, d5nh3i2, d5nh3l1, d5nh3l2, d5nh3m1, d5nh3m2
    automated match to d1btea_
    complexed with nag

Details for d5nh3b_

PDB Entry: 5nh3 (more details), 2.35 Å

PDB Description: crystal structure of the activin receptor type-2a ligand binding domain in complex with bimagrumab fv
PDB Compounds: (B:) Activin receptor type-2A

SCOPe Domain Sequences for d5nh3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nh3b_ g.7.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setqeclffnanwekdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddin
cydrtdcvekkdspevyfcccegnmcnekfsyfpe

SCOPe Domain Coordinates for d5nh3b_:

Click to download the PDB-style file with coordinates for d5nh3b_.
(The format of our PDB-style files is described here.)

Timeline for d5nh3b_: