Class g: Small proteins [56992] (94 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
Protein automated matches [254536] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255202] (2 PDB entries) |
Domain d5nh3b_: 5nh3 B: [341579] Other proteins in same PDB: d5nh3h1, d5nh3h2, d5nh3i1, d5nh3i2, d5nh3l1, d5nh3l2, d5nh3m1, d5nh3m2 automated match to d1btea_ complexed with nag |
PDB Entry: 5nh3 (more details), 2.35 Å
SCOPe Domain Sequences for d5nh3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nh3b_ g.7.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} setqeclffnanwekdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddin cydrtdcvekkdspevyfcccegnmcnekfsyfpe
Timeline for d5nh3b_: