Lineage for d5m6ad1 (5m6a D:1-111)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032427Domain d5m6ad1: 5m6a D:1-111 [341574]
    Other proteins in same PDB: d5m6aa2, d5m6ab2, d5m6ac2, d5m6ad2
    automated match to d2mcg11
    complexed with gol, po4

Details for d5m6ad1

PDB Entry: 5m6a (more details), 1.64 Å

PDB Description: crystal structure of cardiotoxic bence-jones light chain dimer h9
PDB Compounds: (D:) Bence-Jones light chain

SCOPe Domain Sequences for d5m6ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m6ad1 b.1.1.0 (D:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqppsasgspgqsvtisctgtssdvggsdsvswyqqhpgkapkliiyevsqrpsgv
pnrfsgsksgntasltvsglqaeddadyycssyggdnnlffgggtkvtvlg

SCOPe Domain Coordinates for d5m6ad1:

Click to download the PDB-style file with coordinates for d5m6ad1.
(The format of our PDB-style files is described here.)

Timeline for d5m6ad1: