Lineage for d5ngvh1 (5ngv H:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756042Domain d5ngvh1: 5ngv H:1-113 [341567]
    Other proteins in same PDB: d5ngva_, d5ngvh2, d5ngvl2
    automated match to d2d7th_
    complexed with pg4

Details for d5ngvh1

PDB Entry: 5ngv (more details), 2 Å

PDB Description: crystal structure of the activin receptor type-2b ligand binding domain in complex with bimagrumab fv, orthorhombic crystal form
PDB Compounds: (H:) anti-human ActRIIB mAb BYM338 heavy-chain

SCOPe Domain Sequences for d5ngvh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ngvh1 b.1.1.0 (H:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgasvkvsckasgytftssyinwvrqapgqglewmgtinpvsgstsy
aqkfqgrvtmtrdtsistaymelsrlrsddtavyycarggwfdywgqgtlvtv

SCOPe Domain Coordinates for d5ngvh1:

Click to download the PDB-style file with coordinates for d5ngvh1.
(The format of our PDB-style files is described here.)

Timeline for d5ngvh1: