Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.124: NagB/RpiA/CoA transferase [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase [100950] (4 families) |
Family c.124.1.3: CoA transferase beta subunit-like [74657] (2 proteins) catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest |
Protein Glutaconate:CoA transferase beta [53320] (1 species) |
Species Acidaminococcus fermentans [TaxId:905] [53321] (1 PDB entry) |
Domain d1poib_: 1poi B: [34155] Other proteins in same PDB: d1poia_, d1poic_ |
PDB Entry: 1poi (more details), 2.5 Å
SCOP Domain Sequences for d1poib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1poib_ c.124.1.3 (B:) Glutaconate:CoA transferase beta {Acidaminococcus fermentans} dytnytnkemqavtiakqikngqvvtvgtglpligasvakrvyapdchiivesglmdcsp vevprsvgdlrfmahcgciwpnvrfvgfeineylhkanrliafiggaqidpygnvnstsi gdyhhpktrftgsggangiatysntiimmqhekrrfmnkidyvtspgwidgpggrerlgl pgdvgpqlvvtdkgilkfdektkrmylaayyptsspedvlentgfdldvskaveleapdp aviklireeidpgqafiqvp
Timeline for d1poib_: