Lineage for d5lj9a1 (5lj9 A:1-223)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128507Species Escherichia coli [TaxId:83333] [334882] (5 PDB entries)
  8. 2128512Domain d5lj9a1: 5lj9 A:1-223 [341547]
    Other proteins in same PDB: d5lj9a2, d5lj9b2, d5lj9c2
    automated match to d1f3oa_

Details for d5lj9a1

PDB Entry: 5lj9 (more details), 2.3 Å

PDB Description: structure of the e. coli macb abc domain (c2221)
PDB Compounds: (A:) Macrolide export ATP-binding/permease protein macB

SCOPe Domain Sequences for d5lj9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lj9a1 c.37.1.0 (A:1-223) automated matches {Escherichia coli [TaxId: 83333]}
mtpllelkdirrsypagdeqvevlkgisldiyagemvaivgasgsgkstlmnilgcldka
tsgtyrvagqdvatldadalaqlrrehfgfifqryhllshltaeqnvevpavyaglerkq
rllraqellqrlgledrteyypaqlsggqqqrvsiaralmnggqviladeptgaldshsg
eevmailhqlrdrghtviivthdpqvaaqaervieirdgeivr

SCOPe Domain Coordinates for d5lj9a1:

Click to download the PDB-style file with coordinates for d5lj9a1.
(The format of our PDB-style files is described here.)

Timeline for d5lj9a1: