Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Escherichia coli [TaxId:83333] [334882] (5 PDB entries) |
Domain d5lj9a1: 5lj9 A:1-223 [341547] Other proteins in same PDB: d5lj9a2, d5lj9b2, d5lj9c2 automated match to d1f3oa_ |
PDB Entry: 5lj9 (more details), 2.3 Å
SCOPe Domain Sequences for d5lj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lj9a1 c.37.1.0 (A:1-223) automated matches {Escherichia coli [TaxId: 83333]} mtpllelkdirrsypagdeqvevlkgisldiyagemvaivgasgsgkstlmnilgcldka tsgtyrvagqdvatldadalaqlrrehfgfifqryhllshltaeqnvevpavyaglerkq rllraqellqrlgledrteyypaqlsggqqqrvsiaralmnggqviladeptgaldshsg eevmailhqlrdrghtviivthdpqvaaqaervieirdgeivr
Timeline for d5lj9a1:
View in 3D Domains from other chains: (mouse over for more information) d5lj9b1, d5lj9b2, d5lj9c1, d5lj9c2 |