Lineage for d1poic_ (1poi C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318249Fold c.63: CoA transferase [53315] (1 superfamily)
    core: 3 layers: a/b/a; beta-sheet of 7 strands, order 4321567; part of sheet is folded upon itself and forms a barrel-like structure
  4. 318250Superfamily c.63.1: CoA transferase [53316] (2 families) (S)
  5. 318251Family c.63.1.2: alpha subunit-like [74656] (3 proteins)
    parallel beta-sheet
  6. 318256Protein Glutaconate:CoA transferase alpha [53318] (1 species)
  7. 318257Species Acidaminococcus fermentans [TaxId:905] [53319] (1 PDB entry)
  8. 318259Domain d1poic_: 1poi C: [34154]
    Other proteins in same PDB: d1poib_, d1poid_
    complexed with cu

Details for d1poic_

PDB Entry: 1poi (more details), 2.5 Å

PDB Description: crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution

SCOP Domain Sequences for d1poic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poic_ c.63.1.2 (C:) Glutaconate:CoA transferase alpha {Acidaminococcus fermentans}
skvmtlkdaiakyvhsgdhialggfttdrkpyaavfeilrqgitdltglggaaggdwdml
igngrvkayincytansgvtnvsrrfrkwfeagkltmedysqdviymmwhaaalglpflp
vtlmqgsgltdewgiskevrktldkvpddkfkyidnpfkpgekvvavpvpqvdvaiihaq
qaspdgtvriwggkfqdvdiaeaakytivtceeiisdeeirrdptkndipgmcvdavvla
pygahpsqcyglydydnpflkvydkvsktqedfdafckewvfdlkdhdeylnklgatrli
nlkvvpglgyhidmtke

SCOP Domain Coordinates for d1poic_:

Click to download the PDB-style file with coordinates for d1poic_.
(The format of our PDB-style files is described here.)

Timeline for d1poic_: