Lineage for d1poia_ (1poi A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247467Fold c.63: CoA transferase [53315] (1 superfamily)
    core: 3 layers: a/b/a; beta-sheet of 7 strands, order 4321567; part of sheet is folded upon itself and forms a barrel-like structure
  4. 247468Superfamily c.63.1: CoA transferase [53316] (2 families) (S)
  5. 247469Family c.63.1.2: alpha subunit-like [74656] (3 proteins)
    parallel beta-sheet
  6. 247474Protein Glutaconate:CoA transferase alpha [53318] (1 species)
  7. 247475Species Acidaminococcus fermentans [TaxId:905] [53319] (1 PDB entry)
  8. 247476Domain d1poia_: 1poi A: [34153]
    Other proteins in same PDB: d1poib_, d1poid_

Details for d1poia_

PDB Entry: 1poi (more details), 2.5 Å

PDB Description: crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution

SCOP Domain Sequences for d1poia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poia_ c.63.1.2 (A:) Glutaconate:CoA transferase alpha {Acidaminococcus fermentans}
skvmtlkdaiakyvhsgdhialggfttdrkpyaavfeilrqgitdltglggaaggdwdml
igngrvkayincytansgvtnvsrrfrkwfeagkltmedysqdviymmwhaaalglpflp
vtlmqgsgltdewgiskevrktldkvpddkfkyidnpfkpgekvvavpvpqvdvaiihaq
qaspdgtvriwggkfqdvdiaeaakytivtceeiisdeeirrdptkndipgmcvdavvla
pygahpsqcyglydydnpflkvydkvsktqedfdafckewvfdlkdhdeylnklgatrli
nlkvvpglgyhidmtke

SCOP Domain Coordinates for d1poia_:

Click to download the PDB-style file with coordinates for d1poia_.
(The format of our PDB-style files is described here.)

Timeline for d1poia_: