Lineage for d1poia_ (1poi A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26032Fold c.63: Glutaconate-CoA transferase subunits [53315] (1 superfamily)
  4. 26033Superfamily c.63.1: Glutaconate-CoA transferase subunits [53316] (1 family) (S)
  5. 26034Family c.63.1.1: Glutaconate-CoA transferase subunits [53317] (2 proteins)
  6. 26035Protein Glutaconate-CoA transferase alpha [53318] (1 species)
  7. 26036Species Acidaminococcus fermentans [TaxId:905] [53319] (1 PDB entry)
  8. 26037Domain d1poia_: 1poi A: [34153]
    Other proteins in same PDB: d1poib_, d1poid_

Details for d1poia_

PDB Entry: 1poi (more details), 2.5 Å

PDB Description: crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution

SCOP Domain Sequences for d1poia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poia_ c.63.1.1 (A:) Glutaconate-CoA transferase alpha {Acidaminococcus fermentans}
skvmtlkdaiakyvhsgdhialggfttdrkpyaavfeilrqgitdltglggaaggdwdml
igngrvkayincytansgvtnvsrrfrkwfeagkltmedysqdviymmwhaaalglpflp
vtlmqgsgltdewgiskevrktldkvpddkfkyidnpfkpgekvvavpvpqvdvaiihaq
qaspdgtvriwggkfqdvdiaeaakytivtceeiisdeeirrdptkndipgmcvdavvla
pygahpsqcyglydydnpflkvydkvsktqedfdafckewvfdlkdhdeylnklgatrli
nlkvvpglgyhidmtke

SCOP Domain Coordinates for d1poia_:

Click to download the PDB-style file with coordinates for d1poia_.
(The format of our PDB-style files is described here.)

Timeline for d1poia_: