SCOPe 2.06: Domain d5m2tb_: 5m2t B:

Lineage for d5m2tb_ (5m2t B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (6 species)

7. Species Vibrio cholerae [TaxId:243277] [224899] (15 PDB entries)

8. Domain d5m2tb_: 5m2t B: [341523]
   automated match to d5efob_
   complexed with cl, edo, mg, na, uri

Details for d5m2tb_

PDB Entry: 5m2t, 1.03 Å

PDB Description: x-ray structure of uridine phosphorylase from vibrio cholerae in complex with uridine at 1.03 a resolution

PDB Compounds: (B:) Uridine phosphorylase

SCOPe Domain Sequences for d5m2tb_:

Sequence; same for both SEQRES and ATOM records:

>d5m2tb_ c.56.2.1 (B:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
tktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsv
vvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslh
fapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqg
smkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsi
kvvveaarkmlk

Timeline for d5m2tb_:

• d5m2tb_ is new in SCOPe 2.06-stable
  
• d5m2tb_ appears in SCOPe 2.07
  
• d5m2tb_ appears in the current release, SCOPe 2.08