SCOPe 2.08: Domain d6b0hc2: 6b0h C:107-213

Lineage for d6b0hc2 (6b0h C:107-213)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d6b0hc2: 6b0h C:107-213 [341513]
Other proteins in same PDB: d6b0ha1, d6b0hb1, d6b0hb2, d6b0hc1, d6b0hd1, d6b0hd2
automated match to d1dn0a2
complexed with edo

Details for d6b0hc2

PDB Entry: 6b0h (more details), 2.7 Å

PDB Description: crystal structure of pfs25 in complex with the transmission blocking antibody 1262

PDB Compounds: (C:) 1262 antibody, light chain

SCOPe Domain Sequences for d6b0hc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b0hc2 b.1.1.2 (C:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6b0hc2:

Click to download the PDB-style file with coordinates for d6b0hc2.
(The format of our PDB-style files is described here.)

Timeline for d6b0hc2: