SCOPe 2.08: Domain d5m6ac2: 5m6a C:112-213

Lineage for d5m6ac2 (5m6a C:112-213)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d5m6ac2: 5m6a C:112-213 [341510]
Other proteins in same PDB: d5m6aa1, d5m6ab1, d5m6ac1, d5m6ad1
automated match to d2fb4l2
complexed with gol, po4

Details for d5m6ac2

PDB Entry: 5m6a (more details), 1.64 Å

PDB Description: crystal structure of cardiotoxic bence-jones light chain dimer h9

PDB Compounds: (C:) Bence-Jones light chain

SCOPe Domain Sequences for d5m6ac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m6ac2 b.1.1.2 (C:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d5m6ac2:

Click to download the PDB-style file with coordinates for d5m6ac2.
(The format of our PDB-style files is described here.)

Timeline for d5m6ac2: